![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (2 proteins) |
![]() | Domain d2uwma3: 2uwm A:575-633 [139994] automatically matched to d1lvaa4 protein/RNA complex |
PDB Entry: 2uwm (more details), 2.31 Å
SCOPe Domain Sequences for d2uwma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uwma3 a.4.5.35 (A:575-633) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} qalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrvvvg
Timeline for d2uwma3: