Lineage for d2uwma2 (2uwm A:511-574)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635621Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (1 protein)
  6. 635622Protein C-terminal fragment of elongation factor SelB [74684] (1 species)
    duplication: tandem repeat of four "winged helix" domains
  7. 635623Species Moorella thermoacetica [TaxId:1525] [74685] (3 PDB entries)
  8. 635629Domain d2uwma2: 2uwm A:511-574 [139993]
    automatically matched to d1lvaa3

Details for d2uwma2

PDB Entry: 2uwm (more details), 2.31 Å

PDB Description: c-terminal domain(wh2-wh4) of elongation factor selb in complex with secis rna
PDB Compounds: (A:) Selenocysteine-specific elongation factor

SCOP Domain Sequences for d2uwma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uwma2 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
fsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvregvlvkindef
ywhr

SCOP Domain Coordinates for d2uwma2:

Click to download the PDB-style file with coordinates for d2uwma2.
(The format of our PDB-style files is described here.)

Timeline for d2uwma2: