| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (1 protein) |
| Protein C-terminal fragment of elongation factor SelB [74684] (1 species) duplication: tandem repeat of four "winged helix" domains |
| Species Moorella thermoacetica [TaxId:1525] [74685] (3 PDB entries) |
| Domain d2uwma2: 2uwm A:511-574 [139993] automatically matched to d1lvaa3 |
PDB Entry: 2uwm (more details), 2.31 Å
SCOP Domain Sequences for d2uwma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uwma2 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
fsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvregvlvkindef
ywhr
Timeline for d2uwma2: