Lineage for d2uwda_ (2uwd A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2579778Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2580057Protein automated matches [190229] (13 species)
    not a true protein
  7. 2580090Species Human (Homo sapiens) [TaxId:9606] [187292] (156 PDB entries)
  8. 2580156Domain d2uwda_: 2uwd A: [139989]
    automated match to d1osfa_
    complexed with 2gg, mg, so4

Details for d2uwda_

PDB Entry: 2uwd (more details), 1.9 Å

PDB Description: inhibition of the hsp90 molecular chaperone in vitro and in vivo by novel, synthetic, potent resorcinylic pyrazole, isoxazole amide analogs
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d2uwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uwda_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d2uwda_:

Click to download the PDB-style file with coordinates for d2uwda_.
(The format of our PDB-style files is described here.)

Timeline for d2uwda_: