SCOP 1.75: Domain d2uvwa1: 2uvw A:241-342

Lineage for d2uvwa1 (2uvw A:241-342)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (3 species)

7. Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (50 PDB entries)

8. Domain d2uvwa1: 2uvw A:241-342 [139986]
   Other proteins in same PDB: d2uvwa2
   automatically matched to d1n48a1
   complexed with 8og, ca, dgt; mutant

Details for d2uvwa1

PDB Entry: 2uvw, 2.09 Å

PDB Description: crystal structures of mutant dpo4 dna polymerases with 8-oxog containing dna template-primer constructs

PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d2uvwa1:

Sequence; same for both SEQRES and ATOM records:

>d2uvwa1 d.240.1.1 (A:241-342) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkireigvrfskfie

Timeline for d2uvwa1:

• d2uvwa1 first appeared in SCOP 1.73
  
• d2uvwa1 appears in SCOPe 2.01
  
• d2uvwa1 appears in the current release, SCOPe 2.08