Lineage for d2uvva2 (2uvv A:1-240)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2623694Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 2623799Protein automated matches [231300] (5 species)
    not a true protein
  7. 2623819Species Sulfolobus solfataricus [TaxId:273057] [231301] (28 PDB entries)
  8. 2623830Domain d2uvva2: 2uvv A:1-240 [139985]
    Other proteins in same PDB: d2uvva1
    automated match to d1jx4a2
    complexed with ca, dgt; mutant

Details for d2uvva2

PDB Entry: 2uvv (more details), 2.2 Å

PDB Description: crystal structures of mutant dpo4 dna polymerases with 8-oxog containing dna template-primer constructs
PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2uvva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uvva2 e.8.1.7 (A:1-240) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

SCOPe Domain Coordinates for d2uvva2:

Click to download the PDB-style file with coordinates for d2uvva2.
(The format of our PDB-style files is described here.)

Timeline for d2uvva2: