Lineage for d2uvva2 (2uvv A:1-240)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743030Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 743031Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 743539Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 743540Protein DinB homolog (DBH) [100889] (2 species)
  7. 743546Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (41 PDB entries)
  8. 743565Domain d2uvva2: 2uvv A:1-240 [139985]
    Other proteins in same PDB: d2uvva1
    automatically matched to d1jx4a2
    complexed with 8og, ca, dgt; mutant

Details for d2uvva2

PDB Entry: 2uvv (more details), 2.2 Å

PDB Description: crystal structures of mutant dpo4 dna polymerases with 8-oxog containing dna template-primer constructs
PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d2uvva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uvva2 e.8.1.7 (A:1-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

SCOP Domain Coordinates for d2uvva2:

Click to download the PDB-style file with coordinates for d2uvva2.
(The format of our PDB-style files is described here.)

Timeline for d2uvva2: