Lineage for d2uvua1 (2uvu A:241-343)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614248Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 2614249Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 2614349Family d.240.1.0: automated matches [231323] (1 protein)
    not a true family
  6. 2614350Protein automated matches [231324] (5 species)
    not a true protein
  7. 2614372Species Sulfolobus solfataricus [TaxId:273057] [231327] (33 PDB entries)
  8. 2614390Domain d2uvua1: 2uvu A:241-343 [139982]
    Other proteins in same PDB: d2uvua2, d2uvua3
    automated match to d1jx4a1
    complexed with ca, dgt; mutant

Details for d2uvua1

PDB Entry: 2uvu (more details), 2.7 Å

PDB Description: crystal structures of mutant dpo4 dna polymerases with 8-oxog containing dna template-primer constructs
PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2uvua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uvua1 d.240.1.0 (A:241-343) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkiraigvrfskfiea

SCOPe Domain Coordinates for d2uvua1:

Click to download the PDB-style file with coordinates for d2uvua1.
(The format of our PDB-style files is described here.)

Timeline for d2uvua1: