Lineage for d2uvra1 (2uvr A:241-342)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240610Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 2240611Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 2240711Family d.240.1.0: automated matches [231323] (1 protein)
    not a true family
  6. 2240712Protein automated matches [231324] (4 species)
    not a true protein
  7. 2240732Species Sulfolobus solfataricus [TaxId:273057] [231327] (33 PDB entries)
  8. 2240756Domain d2uvra1: 2uvr A:241-342 [139980]
    Other proteins in same PDB: d2uvra2
    automated match to d1jx4a1
    complexed with ca, dgt; mutant

Details for d2uvra1

PDB Entry: 2uvr (more details), 2.9 Å

PDB Description: crystal structures of mutant dpo4 dna polymerases with 8-oxog containing dna template-primer constructs
PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2uvra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uvra1 d.240.1.0 (A:241-342) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkiraigvrfskfie

SCOPe Domain Coordinates for d2uvra1:

Click to download the PDB-style file with coordinates for d2uvra1.
(The format of our PDB-style files is described here.)

Timeline for d2uvra1: