Lineage for d2uuct1 (2uuc T:8-106)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2310051Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
    automatically mapped to Pfam PF01649
  5. 2310052Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 2310053Protein Ribosomal protein S20 [46994] (2 species)
  7. 2310081Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries)
    Uniprot P80380
  8. 2310103Domain d2uuct1: 2uuc T:8-106 [139971]
    Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uucu1
    automatically matched to d1i94t_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uuct1

PDB Entry: 2uuc (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
PDB Compounds: (T:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2uuct1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuct1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOPe Domain Coordinates for d2uuct1:

Click to download the PDB-style file with coordinates for d2uuct1.
(The format of our PDB-style files is described here.)

Timeline for d2uuct1: