![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
![]() | Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() automatically mapped to Pfam PF00203 |
![]() | Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
![]() | Protein Ribosomal protein S19 [54572] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries) Uniprot P80381 |
![]() | Domain d2uucs1: 2uuc S:2-81 [139970] Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uuct1, d2uucu1 automatically matched to d1fjgs_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uuc (more details), 3.1 Å
SCOPe Domain Sequences for d2uucs1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uucs1 d.28.1.1 (S:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]} prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy itenmvghklgefaptrtyr
Timeline for d2uucs1: