Lineage for d2uucn1 (2uuc N:2-61)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065411Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1065412Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1065744Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 1065745Protein Ribosomal protein S14 [57753] (2 species)
  7. 1065771Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 1065778Domain d2uucn1: 2uuc N:2-61 [139965]
    Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uuct1, d2uucu1
    automatically matched to d1fjgn_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uucn1

PDB Entry: 2uuc (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2uucn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uucn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d2uucn1:

Click to download the PDB-style file with coordinates for d2uucn1.
(The format of our PDB-style files is described here.)

Timeline for d2uucn1: