Lineage for d2uucm1 (2uuc M:2-126)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017655Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2017656Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2017657Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
    automatically mapped to Pfam PF00416
  6. 2017658Protein Ribosomal protein S13 [46948] (2 species)
  7. 2017686Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries)
    Uniprot P80377
  8. 2017693Domain d2uucm1: 2uuc M:2-126 [139964]
    Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucn1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uuct1, d2uucu1
    automatically matched to d1fjgm_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uucm1

PDB Entry: 2uuc (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
PDB Compounds: (M:) 30S ribosomal protein S13

SCOPe Domain Sequences for d2uucm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uucm1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOPe Domain Coordinates for d2uucm1:

Click to download the PDB-style file with coordinates for d2uucm1.
(The format of our PDB-style files is described here.)

Timeline for d2uucm1: