![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
![]() | Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) ![]() contains a helix-two turns-helix (H2TH) motif |
![]() | Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension automatically mapped to Pfam PF00416 |
![]() | Protein Ribosomal protein S13 [46948] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries) Uniprot P80377 |
![]() | Domain d2uucm1: 2uuc M:2-126 [139964] Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucn1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uuct1, d2uucu1 automatically matched to d1fjgm_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uuc (more details), 3.1 Å
SCOPe Domain Sequences for d2uucm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uucm1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk kaprk
Timeline for d2uucm1: