Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) automatically mapped to Pfam PF00338 |
Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
Protein Ribosomal protein S10 [55001] (2 species) |
Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries) Uniprot P80375 |
Domain d2uucj1: 2uuc J:3-100 [139961] Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uuct1, d2uucu1 automatically matched to d1fjgj_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uuc (more details), 3.1 Å
SCOPe Domain Sequences for d2uucj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uucj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]} kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh felrthnrlvdiinpnrktieqlmtldlptgveieikt
Timeline for d2uucj1: