Lineage for d2uucf1 (2uuc F:1-101)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909830Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1909831Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1909832Protein Ribosomal protein S6 [54997] (4 species)
  7. 1909862Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 1909874Domain d2uucf1: 2uuc F:1-101 [139958]
    Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uuct1, d2uucu1
    automatically matched to d1fjgf_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uucf1

PDB Entry: 2uuc (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2uucf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uucf1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d2uucf1:

Click to download the PDB-style file with coordinates for d2uucf1.
(The format of our PDB-style files is described here.)

Timeline for d2uucf1: