Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) fold elaborated with additional structures |
Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
Protein Ribosomal protein S2 [52315] (3 species) |
Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries) Uniprot P80371 |
Domain d2uucb1: 2uuc B:7-240 [139952] Other proteins in same PDB: d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uuct1, d2uucu1 automatically matched to d1i94b_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uuc (more details), 3.1 Å
SCOPe Domain Sequences for d2uucb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uucb1 c.23.15.1 (B:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
Timeline for d2uucb1: