Lineage for d2uubr1 (2uub R:19-88)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984966Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1984967Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1984968Protein Ribosomal protein S18 [46913] (2 species)
  7. 1984994Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 1984995Domain d2uubr1: 2uub R:19-88 [139949]
    Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubs1, d2uubt1, d2uubu1
    automatically matched to 2J00 R:19-88
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uubr1

PDB Entry: 2uub (more details), 2.9 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2uubr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uubr1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl
lpfteklvrk

SCOPe Domain Coordinates for d2uubr1:

Click to download the PDB-style file with coordinates for d2uubr1.
(The format of our PDB-style files is described here.)

Timeline for d2uubr1: