![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.4: Translational machinery components [53137] (3 families) ![]() |
![]() | Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
![]() | Protein Ribosomal protein S11 [53141] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries) Uniprot P80376 |
![]() | Domain d2uubk1: 2uub K:11-129 [139942] Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1, d2uubu1 automatically matched to d1i94k_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uub (more details), 2.9 Å
SCOPe Domain Sequences for d2uubk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uubk1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]} krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
Timeline for d2uubk1: