Lineage for d2uubj1 (2uub J:3-100)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196721Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
    automatically mapped to Pfam PF00338
  5. 2196722Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 2196723Protein Ribosomal protein S10 [55001] (2 species)
  7. 2196749Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
    Uniprot P80375
  8. 2196750Domain d2uubj1: 2uub J:3-100 [139941]
    Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1, d2uubu1
    automatically matched to d1fjgj_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uubj1

PDB Entry: 2uub (more details), 2.9 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d2uubj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uubj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOPe Domain Coordinates for d2uubj1:

Click to download the PDB-style file with coordinates for d2uubj1.
(The format of our PDB-style files is described here.)

Timeline for d2uubj1: