Lineage for d2uubd1 (2uub D:2-209)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1419099Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 1419100Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 1419101Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 1419102Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 1419133Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)
  8. 1419134Domain d2uubd1: 2uub D:2-209 [139935]
    Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1, d2uubu1
    automatically matched to d1hnwd_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uubd1

PDB Entry: 2uub (more details), 2.9 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d2uubd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uubd1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOPe Domain Coordinates for d2uubd1:

Click to download the PDB-style file with coordinates for d2uubd1.
(The format of our PDB-style files is described here.)

Timeline for d2uubd1: