SCOP 1.73: Domain d2uubc1: 2uub C:2-106

Lineage for d2uubc1 (2uub C:2-106)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)

8. Domain d2uubc1: 2uub C:2-106 [139933]
   Other proteins in same PDB: d2uubb1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1
   automatically matched to d1fjgc1
   complexed with 6mz, cm0, k, mg, par, zn

Details for d2uubc1

PDB Entry: 2uub, 2.8 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d2uubc1:

Sequence; same for both SEQRES and ATOM records:

>d2uubc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d2uubc1:

• d2uubc1 is new in SCOP 1.73
  
• d2uubc1 appears in SCOP 1.75
  
• d2uubc1 appears in the current release, SCOPe 2.08