Lineage for d2uuap1 (2uua P:1-83)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549131Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 2549132Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 2549133Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 2549134Protein Ribosomal protein S16 [54567] (3 species)
  7. 2549164Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
    Uniprot P80379
  8. 2549177Domain d2uuap1: 2uua P:1-83 [139927]
    Other proteins in same PDB: d2uuab1, d2uuac1, d2uuac2, d2uuad1, d2uuae1, d2uuae2, d2uuaf1, d2uuag1, d2uuah1, d2uuaj1, d2uuak1, d2uual1, d2uuam1, d2uuan1, d2uuao1, d2uuaq1, d2uuar1, d2uuas1, d2uuat1, d2uuau1
    automatically matched to d1emwa_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uuap1

PDB Entry: 2uua (more details), 2.9 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2uuap1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuap1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOPe Domain Coordinates for d2uuap1:

Click to download the PDB-style file with coordinates for d2uuap1.
(The format of our PDB-style files is described here.)

Timeline for d2uuap1: