Lineage for d2uuaj1 (2uua J:3-100)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862993Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 862994Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 862995Protein Ribosomal protein S10 [55001] (2 species)
  7. 863021Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
    Uniprot P80375
  8. 863029Domain d2uuaj1: 2uua J:3-100 [139921]
    Other proteins in same PDB: d2uuab1, d2uuac1, d2uuac2, d2uuad1, d2uuae1, d2uuae2, d2uuaf1, d2uuag1, d2uuah1, d2uuak1, d2uual1, d2uuam1, d2uuan1, d2uuao1, d2uuap1, d2uuaq1, d2uuar1, d2uuas1, d2uuat1, d2uuau1
    automatically matched to d1fjgj_
    complexed with 6mz, cm0, k, mg, par, zn

Details for d2uuaj1

PDB Entry: 2uua (more details), 2.9 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
PDB Compounds: (J:) 30S ribosomal protein S10

SCOP Domain Sequences for d2uuaj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuaj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d2uuaj1:

Click to download the PDB-style file with coordinates for d2uuaj1.
(The format of our PDB-style files is described here.)

Timeline for d2uuaj1: