SCOPe 2.04: Domain d2uuae1: 2uua E:74-154

Lineage for d2uuae1 (2uua E:74-154)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
   Uniprot P27152 ! Uniprot P80373

8. Domain d2uuae1: 2uua E:74-154 [139916]
   Other proteins in same PDB: d2uuab1, d2uuac1, d2uuac2, d2uuad1, d2uuae2, d2uuaf1, d2uuag1, d2uuah1, d2uuaj1, d2uuak1, d2uual1, d2uuam1, d2uuan1, d2uuao1, d2uuap1, d2uuaq1, d2uuar1, d2uuas1, d2uuat1, d2uuau1
   automatically matched to d1i94e1
   protein/RNA complex; complexed with k, mg, par, zn

Details for d2uuae1

PDB Entry: 2uua, 2.9 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2uuae1:

Sequence; same for both SEQRES and ATOM records:

>d2uuae1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d2uuae1:

• d2uuae1 first appeared in SCOP 1.73
  
• d2uuae1 appears in SCOPe 2.03
  
• d2uuae1 appears in SCOPe 2.05
  
• d2uuae1 appears in the current release, SCOPe 2.08