Class a: All alpha proteins [46456] (258 folds) |
Fold a.7: Spectrin repeat-like [46965] (15 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) |
Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
Protein Ribosomal protein S20 [46994] (1 species) |
Species Thermus thermophilus [TaxId:274] [46995] (36 PDB entries) |
Domain d2uu9t1: 2uu9 T:8-106 [139911] Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9d1, d2uu9e1, d2uu9e2, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9k1, d2uu9l1, d2uu9m1, d2uu9n1, d2uu9o1, d2uu9p1, d2uu9q1, d2uu9r1, d2uu9s1 automatically matched to d1i94t_ complexed with 6mz, cm0, k, mg, par, zn |
PDB Entry: 2uu9 (more details), 3.1 Å
SCOP Domain Sequences for d2uu9t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uu9t1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]} rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d2uu9t1: