Lineage for d2uu9p1 (2uu9 P:1-83)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942074Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 2942075Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 2942076Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 2942077Protein Ribosomal protein S16 [54567] (3 species)
  7. 2942107Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
    Uniprot P80379
  8. 2942126Domain d2uu9p1: 2uu9 P:1-83 [139907]
    Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9d1, d2uu9e1, d2uu9e2, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9k1, d2uu9l1, d2uu9m1, d2uu9n1, d2uu9o1, d2uu9q1, d2uu9r1, d2uu9s1, d2uu9t1, d2uu9u1
    automatically matched to d1emwa_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uu9p1

PDB Entry: 2uu9 (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2uu9p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uu9p1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOPe Domain Coordinates for d2uu9p1:

Click to download the PDB-style file with coordinates for d2uu9p1.
(The format of our PDB-style files is described here.)

Timeline for d2uu9p1: