Lineage for d2uu9o1 (2uu9 O:2-89)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637242Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 637243Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 637252Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 637253Protein Ribosomal protein S15 [47065] (2 species)
  7. 637256Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
  8. 637280Domain d2uu9o1: 2uu9 O:2-89 [139906]
    Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9d1, d2uu9e1, d2uu9e2, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9k1, d2uu9l1, d2uu9m1, d2uu9n1, d2uu9p1, d2uu9q1, d2uu9r1, d2uu9s1, d2uu9t1
    automatically matched to d1ab3__
    complexed with 6mz, cm0, k, mg, par, zn

Details for d2uu9o1

PDB Entry: 2uu9 (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
PDB Compounds: (O:) 30S ribosomal protein S15

SCOP Domain Sequences for d2uu9o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uu9o1 a.16.1.2 (O:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d2uu9o1:

Click to download the PDB-style file with coordinates for d2uu9o1.
(The format of our PDB-style files is described here.)

Timeline for d2uu9o1: