SCOPe 2.02: Domain d2uu9n1: 2uu9 N:2-61

Lineage for d2uu9n1 (2uu9 N:2-61)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
   Uniprot P24320

8. Domain d2uu9n1: 2uu9 N:2-61 [139905]
   Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9d1, d2uu9e1, d2uu9e2, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9k1, d2uu9l1, d2uu9m1, d2uu9o1, d2uu9p1, d2uu9q1, d2uu9r1, d2uu9s1, d2uu9t1, d2uu9u1
   automatically matched to d1fjgn_
   protein/RNA complex; complexed with k, mg, par, zn

Details for d2uu9n1

PDB Entry: 2uu9, 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.

PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2uu9n1:

Sequence; same for both SEQRES and ATOM records:

>d2uu9n1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d2uu9n1:

• d2uu9n1 first appeared in SCOP 1.73
  
• d2uu9n1 appears in SCOPe 2.01
  
• d2uu9n1 appears in SCOPe 2.03
  
• d2uu9n1 appears in the current release, SCOPe 2.08