Lineage for d2uu9e2 (2uu9 E:5-73)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904269Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1904270Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 1904351Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
    automatically mapped to Pfam PF00333
  6. 1904352Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
    lacks the N-terminal helix
  7. 1904380Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)
    Uniprot P27152
  8. 1904388Domain d2uu9e2: 2uu9 E:5-73 [139897]
    Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9d1, d2uu9e1, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9k1, d2uu9l1, d2uu9m1, d2uu9n1, d2uu9o1, d2uu9p1, d2uu9q1, d2uu9r1, d2uu9s1, d2uu9t1, d2uu9u1
    automatically matched to d1i94e2
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uu9e2

PDB Entry: 2uu9 (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2uu9e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uu9e2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOPe Domain Coordinates for d2uu9e2:

Click to download the PDB-style file with coordinates for d2uu9e2.
(The format of our PDB-style files is described here.)

Timeline for d2uu9e2: