| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) ![]() common motif in otherwise different folds |
| Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
| Protein Ribosomal protein S4 [55179] (2 species) also contains a Zn-binding N-terminal subdomain |
| Species Thermus thermophilus [TaxId:274] [55180] (36 PDB entries) |
| Domain d2uu9d1: 2uu9 D:2-209 [139895] Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9e1, d2uu9e2, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9k1, d2uu9l1, d2uu9m1, d2uu9n1, d2uu9o1, d2uu9p1, d2uu9q1, d2uu9r1, d2uu9s1, d2uu9t1 automatically matched to d1hnwd_ complexed with 6mz, cm0, k, mg, par, zn |
PDB Entry: 2uu9 (more details), 3.1 Å
SCOP Domain Sequences for d2uu9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uu9d1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr
Timeline for d2uu9d1: