Lineage for d2uu9c2 (2uu9 C:107-207)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722852Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 722853Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 722854Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 722855Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)
  7. 722856Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
  8. 722877Domain d2uu9c2: 2uu9 C:107-207 [139894]
    Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9d1, d2uu9e1, d2uu9e2, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9k1, d2uu9l1, d2uu9m1, d2uu9n1, d2uu9o1, d2uu9p1, d2uu9q1, d2uu9r1, d2uu9s1, d2uu9t1
    automatically matched to d1fjgc2
    complexed with 6mz, cm0, k, mg, par, zn

Details for d2uu9c2

PDB Entry: 2uu9 (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d2uu9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uu9c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d2uu9c2:

Click to download the PDB-style file with coordinates for d2uu9c2.
(The format of our PDB-style files is described here.)

Timeline for d2uu9c2: