SCOPe 2.07: Domain d2q5uc1: 2q5u C:1-45

Lineage for d2q5uc1 (2q5u C:1-45)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (2 families)

5. Family h.3.2.1: Virus ectodomain [58070] (9 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (4 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)

8. Domain d2q5uc1: 2q5u C:1-45 [139886]
   complexed with cl

Details for d2q5uc1

PDB Entry: 2q5u, 1.5 Å

PDB Description: Crystal structure of IQN17

PDB Compounds: (C:) Fusion protein between yeast variant GCN4 and HIVgp41

SCOPe Domain Sequences for d2q5uc1:

Sequence; same for both SEQRES and ATOM records:

>d2q5uc1 h.3.2.1 (C:1-45) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril

Timeline for d2q5uc1:

• d2q5uc1 first appeared in SCOP 1.73
  
• d2q5uc1 appears in SCOPe 2.06
  
• d2q5uc1 appears in the current release, SCOPe 2.08