Lineage for d2q5ua1 (2q5u A:1-45)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 753258Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 753377Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. 753378Family h.3.2.1: Virus ectodomain [58070] (8 proteins)
  6. 753421Protein Retrovius gp41 protease-resistant core [58071] (3 species)
    coiled coil; biological unit: trimer
  7. 753422Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (19 PDB entries)
  8. 753426Domain d2q5ua1: 2q5u A:1-45 [139884]

Details for d2q5ua1

PDB Entry: 2q5u (more details), 1.5 Å

PDB Description: Crystal structure of IQN17
PDB Compounds: (A:) Fusion protein between yeast variant GCN4 and HIVgp41

SCOP Domain Sequences for d2q5ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q5ua1 h.3.2.1 (A:1-45) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril

SCOP Domain Coordinates for d2q5ua1:

Click to download the PDB-style file with coordinates for d2q5ua1.
(The format of our PDB-style files is described here.)

Timeline for d2q5ua1: