SCOPe 2.07: Domain d2q4xa_: 2q4x A:

Lineage for d2q4xa_ (2q4x A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein automated matches [190357] (2 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187186] (1 PDB entry)

8. Domain d2q4xa_: 2q4x A: [139880]
   automated match to d1q4mb_
   complexed with hmh, so4

Details for d2q4xa_

PDB Entry: 2q4x, 2.1 Å

PDB Description: ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at3g16990

PDB Compounds: (A:) seed maturation protein pm36 homolog

SCOPe Domain Sequences for d2q4xa_:

Sequence; same for both SEQRES and ATOM records:

>d2q4xa_ a.132.1.3 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvlir
ackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlms
sevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssvknia
erclenasgevlgeaedvlvrvlelevafwemsrg

Timeline for d2q4xa_:

• d2q4xa_ first appeared in SCOP 1.73, called d2q4xa1
  
• d2q4xa_ appears in SCOPe 2.06
  
• d2q4xa_ appears in the current release, SCOPe 2.08