SCOP 1.73: Domain d2q4xa1: 2q4x A:5-219

Lineage for d2q4xa1 (2q4x A:5-219)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (8 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein Seed maturation protein-related At3g16990 [101461] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101462] (2 PDB entries)
   structural genomics

8. Domain d2q4xa1: 2q4x A:5-219 [139880]
   automatically matched to d1q4mb_
   complexed with hmh, so4

Details for d2q4xa1

PDB Entry: 2q4x, 2.1 Å

PDB Description: ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at3g16990

PDB Compounds: (A:) seed maturation protein pm36 homolog

SCOP Domain Sequences for d2q4xa1:

Sequence; same for both SEQRES and ATOM records:

>d2q4xa1 a.132.1.3 (A:5-219) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvlir
ackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlms
sevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssvknia
erclenasgevlgeaedvlvrvlelevafwemsrg

Timeline for d2q4xa1:

• d2q4xa1 is new in SCOP 1.73
  
• d2q4xa1 appears in SCOP 1.75
  
• d2q4xa1 appears in the current release, SCOPe 2.08, called d2q4xa_