Lineage for d2q4vb1 (2q4v B:3-169)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731053Protein Diamine acetyltransferase 2 [143688] (1 species)
  7. 731054Species Human (Homo sapiens) [TaxId:9606] [143689] (2 PDB entries)
  8. 731056Domain d2q4vb1: 2q4v B:3-169 [139879]
    automatically matched to 2BEI A:3-169
    complexed with aco

Details for d2q4vb1

PDB Entry: 2q4v (more details), 1.84 Å

PDB Description: Ensemble refinement of the protein crystal structure of thialysine n-acetyltransferase (SSAT2) from Homo sapiens
PDB Compounds: (B:) Diamine acetyltransferase 2

SCOP Domain Sequences for d2q4vb1:

Sequence, based on SEQRES records: (download)

>d2q4vb1 d.108.1.1 (B:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]}
svrireakegdcgdilrlirelaefeklsdqvkiseealradgfgdnpfyhclvaeilpa
pgkllgpcvvgygiyyfiystwkgrtiylediyvmpeyrgqgigskiikkvaevaldkgc
sqfrlavldwnqramdlykalgaqdlteaegwhffcfqgeatrklag

Sequence, based on observed residues (ATOM records): (download)

>d2q4vb1 d.108.1.1 (B:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]}
svrireakegdcgdilrlirelaefeklsdqvkiseealradgfgdnpfyhclvaeicvv
gygiyyfiystwkgrtiylediyvmpeyrgqgigskiikkvaevaldkgcsqfrlavldw
nqramdlykalgaqdlteaegwhffcfqgeatrklag

SCOP Domain Coordinates for d2q4vb1:

Click to download the PDB-style file with coordinates for d2q4vb1.
(The format of our PDB-style files is described here.)

Timeline for d2q4vb1: