SCOP 1.73: Domain d2q4qb1: 2q4q B:2-122

Lineage for d2q4qb1 (2q4q B:2-122)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.103: MTH938-like [64075] (1 superfamily)
   core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest

4. Superfamily c.103.1: MTH938-like [64076] (1 family)

5. Family c.103.1.1: MTH938-like [64077] (5 proteins)

6. Protein Hypothetical protein PTD015 (C11orf67) [142443] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142444] (2 PDB entries)

8. Domain d2q4qb1: 2q4q B:2-122 [139875]
   automatically matched to 2AB1 A:2-122

Details for d2q4qb1

PDB Entry: 2q4q, 2.59 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Homo sapiens Hs.95870

PDB Compounds: (B:) UPF0366 protein C11orf67

SCOP Domain Sequences for d2q4qb1:

Sequence, based on SEQRES records:

>d2q4qb1 c.103.1.1 (B:2-122) Hypothetical protein PTD015 (C11orf67) {Human (Homo sapiens) [TaxId: 9606]}
tspeiaslswgqmkvkgsnttykdckvwpggsrtwdwretgtehspgvqpadvkevvekg
vqtlvigrgmsealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhst
c

Sequence, based on observed residues (ATOM records):

>d2q4qb1 c.103.1.1 (B:2-122) Hypothetical protein PTD015 (C11orf67) {Human (Homo sapiens) [TaxId: 9606]}
tspeiaslswgqmkvkgsnttykdckvwpggsrtwdgvqpadvkevvekgvqtlvigrgm
sealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhstc

Timeline for d2q4qb1:

• d2q4qb1 is new in SCOP 1.73
  
• d2q4qb1 appears in SCOP 1.75
  
• d2q4qb1 appears in the current release, SCOPe 2.08, called d2q4qb2