SCOPe 2.05: Domain d2q4ob_: 2q4o B:

Lineage for d2q4ob_ (2q4o B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567

4. Superfamily c.129.1: MCP/YpsA-like [102405] (3 families)

5. Family c.129.1.1: MoCo carrier protein-like [102406] (6 proteins)
   Pfam PF03641

6. Protein Hypothetical protein At2g37210/T2N18.3 [142344] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142345] (2 PDB entries)
   Uniprot Q8L8B8 8-190

8. Domain d2q4ob_: 2q4o B: [139873]
   automated match to d2a33a1
   complexed with mg, so4

Details for d2q4ob_

PDB Entry: 2q4o, 1.95 Å

PDB Description: Ensemble refinement of the crystal structure of a lysine decarboxylase-like protein from Arabidopsis thaliana gene At2g37210

PDB Compounds: (B:) Uncharacterized protein At2g37210/T2N18.3

SCOPe Domain Sequences for d2q4ob_:

Sequence, based on SEQRES records:

>d2q4ob_ c.129.1.1 (B:) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhdgg
rhvigiipktlmpreltgetvgevravadmhqrkaemakhsdafialpggygtleellev
itwaqlgihdkpvgllnvdgyynsllsfidkaveegfisptareiivsaptakelvkkle
e

Sequence, based on observed residues (ATOM records):

>d2q4ob_ c.129.1.1 (B:) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhdgg
rhvigiipkgetvgevravadmhqrkaemakhsdafialpggygtleellevitwaqlgi
hdkpvgllnvdgyynsllsfidkaveegfisptareiivsaptakelvkklee

Timeline for d2q4ob_:

• d2q4ob_ first appeared in SCOP 1.73, called d2q4ob1
  
• d2q4ob_ appears in SCOPe 2.04
  
• d2q4ob_ appears in SCOPe 2.06
  
• d2q4ob_ appears in the current release, SCOPe 2.08