SCOP 1.73: Domain d2q4ob1: 2q4o B:10-190

Lineage for d2q4ob1 (2q4o B:10-190)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.129: MoCo carrier protein-like [102404] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567

4. Superfamily c.129.1: MoCo carrier protein-like [102405] (1 family)

5. Family c.129.1.1: MoCo carrier protein-like [102406] (6 proteins)
   Pfam PF03641

6. Protein Hypothetical protein At2g37210/T2N18.3 [142344] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142345] (2 PDB entries)

8. Domain d2q4ob1: 2q4o B:10-190 [139873]
   automatically matched to 2A33 A:8-190
   complexed with mg, so4

Details for d2q4ob1

PDB Entry: 2q4o, 1.95 Å

PDB Description: Ensemble refinement of the crystal structure of a lysine decarboxylase-like protein from Arabidopsis thaliana gene At2g37210

PDB Compounds: (B:) Uncharacterized protein At2g37210/T2N18.3

SCOP Domain Sequences for d2q4ob1:

Sequence, based on SEQRES records:

>d2q4ob1 c.129.1.1 (B:10-190) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhdgg
rhvigiipktlmpreltgetvgevravadmhqrkaemakhsdafialpggygtleellev
itwaqlgihdkpvgllnvdgyynsllsfidkaveegfisptareiivsaptakelvkkle
e

Sequence, based on observed residues (ATOM records):

>d2q4ob1 c.129.1.1 (B:10-190) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhdgg
rhvigiipkgetvgevravadmhqrkaemakhsdafialpggygtleellevitwaqlgi
hdkpvgllnvdgyynsllsfidkaveegfisptareiivsaptakelvkklee

Timeline for d2q4ob1:

• d2q4ob1 is new in SCOP 1.73
  
• d2q4ob1 appears in SCOP 1.75
  
• d2q4ob1 appears in the current release, SCOPe 2.08, called d2q4ob_