SCOPe 2.06: Domain d2q4ma_: 2q4m A:

Lineage for d2q4ma_ (2q4m A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.23: Tubby C-terminal domain-like [54517] (1 superfamily)
   beta-sheet folds into a barrel (n=12, S=12) around the central helix

4. Superfamily d.23.1: Tubby C-terminal domain-like [54518] (2 families)

5. Family d.23.1.2: At5g01750-like [143104] (1 protein)
   Pfam PF04525; DUF567

6. Protein Hypothetical protein At5g01750 [143105] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [143106] (2 PDB entries)
   Uniprot Q9LZX1 24-212

8. Domain d2q4ma_: 2q4m A: [139870]
   automated match to d1zxua1
   complexed with edo

Details for d2q4ma_

PDB Entry: 2q4m, 1.7 Å

PDB Description: Ensemble refinement of the crystal structure of protein from Arabidopsis thaliana At5g01750

PDB Compounds: (A:) Protein At5g01750

SCOPe Domain Sequences for d2q4ma_:

Sequence, based on SEQRES records:

>d2q4ma_ d.23.1.2 (A:) Hypothetical protein At5g01750 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ggvvvdpkycapypidmaivrkmmsltdgnfvitdvngnllfkvkepvfglhdkrvlldg
sgtpvvtlrekmvsmhdrwqvfrggstdqrdllytvkrssmlqlktkldvflghnkdekr
cdfrvkgswlerscvvyagesdaivaqmhrkhtvqsvflgkdnfsvtvypnvdyafiasl
vvilddvnr

Sequence, based on observed residues (ATOM records):

>d2q4ma_ d.23.1.2 (A:) Hypothetical protein At5g01750 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ggvvvdpkycapypidmaivrkdgnfvitdvngnllfkvkepvfglhdkrvlldgsgtpv
vtlredrwqvfrggstdqrdllytvkrtkldvflghnkdkrcdfrvkgswlerscvvyag
esdaivaqmhrkgkdnfsvtvypnvdyafiaslvvilddvnr

Timeline for d2q4ma_:

• d2q4ma_ first appeared in SCOP 1.73, called d2q4ma1
  
• d2q4ma_ appears in SCOPe 2.05
  
• d2q4ma_ appears in SCOPe 2.07
  
• d2q4ma_ appears in the current release, SCOPe 2.08