Lineage for d2q4ma1 (2q4m A:24-212)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857401Fold d.23: Tubby C-terminal domain-like [54517] (1 superfamily)
    beta-sheet folds into a barrel (n=12, S=12) around the central helix
  4. 857402Superfamily d.23.1: Tubby C-terminal domain-like [54518] (2 families) (S)
  5. 857408Family d.23.1.2: At5g01750-like [143104] (1 protein)
    Pfam PF04525; DUF567
  6. 857409Protein Hypothetical protein At5g01750 [143105] (1 species)
  7. 857410Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [143106] (2 PDB entries)
    Uniprot Q9LZX1 24-212
  8. 857411Domain d2q4ma1: 2q4m A:24-212 [139870]
    automatically matched to 1ZXU A:24-212
    complexed with edo

Details for d2q4ma1

PDB Entry: 2q4m (more details), 1.7 Å

PDB Description: Ensemble refinement of the crystal structure of protein from Arabidopsis thaliana At5g01750
PDB Compounds: (A:) Protein At5g01750

SCOP Domain Sequences for d2q4ma1:

Sequence, based on SEQRES records: (download)

>d2q4ma1 d.23.1.2 (A:24-212) Hypothetical protein At5g01750 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ggvvvdpkycapypidmaivrkmmsltdgnfvitdvngnllfkvkepvfglhdkrvlldg
sgtpvvtlrekmvsmhdrwqvfrggstdqrdllytvkrssmlqlktkldvflghnkdekr
cdfrvkgswlerscvvyagesdaivaqmhrkhtvqsvflgkdnfsvtvypnvdyafiasl
vvilddvnr

Sequence, based on observed residues (ATOM records): (download)

>d2q4ma1 d.23.1.2 (A:24-212) Hypothetical protein At5g01750 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ggvvvdpkycapypidmaivrkdgnfvitdvngnllfkvkepvfglhdkrvlldgsgtpv
vtlredrwqvfrggstdqrdllytvkrtkldvflghnkdkrcdfrvkgswlerscvvyag
esdaivaqmhrkgkdnfsvtvypnvdyafiaslvvilddvnr

SCOP Domain Coordinates for d2q4ma1:

Click to download the PDB-style file with coordinates for d2q4ma1.
(The format of our PDB-style files is described here.)

Timeline for d2q4ma1: