SCOP 1.73: Domain d2q4lb2: 2q4l B:196-350

Lineage for d2q4lb2 (2q4l B:196-350)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (3 families)

5. Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
   duplication: consists of 2 HIT-like motifs
   binds zinc and iron ions

6. Protein Galactose-1-phosphate uridylyltransferase [54208] (2 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110788] (5 PDB entries)

8. Domain d2q4lb2: 2q4l B:196-350 [139869]
   automatically matched to d1vkva2
   complexed with zn

Details for d2q4lb2

PDB Entry: 2q4l, 2.3 Å

PDB Description: Ensemble refinement of the crystal structure of GALT-like protein from Arabidopsis thaliana At5g18200

PDB Compounds: (B:) Probable galactose-1-phosphate uridyl transferase

SCOP Domain Sequences for d2q4lb2:

Sequence; same for both SEQRES and ATOM records:

>d2q4lb2 d.13.1.2 (B:196-350) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapfaatypfeiwiipkdh
sshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplkvtesqlpythwflqi
vpqlsgvggfeigtgcyinpvfpedvakvmrevsl

Timeline for d2q4lb2:

• d2q4lb2 is new in SCOP 1.73
  
• d2q4lb2 appears in SCOP 1.75
  
• d2q4lb2 appears in the current release, SCOPe 2.08