Lineage for d2q4kb1 (2q4k B:17-250)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728664Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 728665Superfamily d.86.1: eIF4e-like [55418] (2 families) (S)
  5. 728684Family d.86.1.2: BLES03-like [143583] (1 protein)
    the N-terminal strand is missing, but there extra C-terminal strands in the beta-sheet
  6. 728685Protein Basophilic leukemia expressed protein BLES03 [143584] (1 species)
  7. 728686Species Human (Homo sapiens) [TaxId:9606] [143585] (2 PDB entries)
  8. 728690Domain d2q4kb1: 2q4k B:17-250 [139865]
    automatically matched to 1ZTP A:17-250

Details for d2q4kb1

PDB Entry: 2q4k (more details), 2.5 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Homo sapiens Hs.433573
PDB Compounds: (B:) Uncharacterized protein C11orf68

SCOP Domain Sequences for d2q4kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q4kb1 d.86.1.2 (B:17-250) Basophilic leukemia expressed protein BLES03 {Human (Homo sapiens) [TaxId: 9606]}
edgftaehlaaeamaadmdpwlvfdarttpateldawlakyppsqvtrygdpgspnsepv
gwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlaithhvlsgkwlmhlapg
fkldhawagiaravvegrlqvakvsprakeggrqvicvytddftdrlgvleadsairaag
ikclltykpdvytylgiyranrwhlcptlyesrfqlggsargsrvldrannvel

SCOP Domain Coordinates for d2q4kb1:

Click to download the PDB-style file with coordinates for d2q4kb1.
(The format of our PDB-style files is described here.)

Timeline for d2q4kb1: