Lineage for d2q4ja2 (2q4j A:6-383)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133197Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 protein domains)
  6. 2133223Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [142686] (1 species)
  7. 2133224Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142687] (4 PDB entries)
    Uniprot Q9M9P3 6-383
  8. 2133229Domain d2q4ja2: 2q4j A:6-383 [139861]
    Other proteins in same PDB: d2q4ja1, d2q4jb1
    automated match to d1z90a2

Details for d2q4ja2

PDB Entry: 2q4j (more details), 1.86 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At3g03250, a putative UDP-glucose pyrophosphorylase
PDB Compounds: (A:) Probable UTP-glucose-1-phosphate uridylyltransferase 2

SCOPe Domain Sequences for d2q4ja2:

Sequence, based on SEQRES records: (download)

>d2q4ja2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
enlpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpyekmtp
vsqdvaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnky
gckvplvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdke
gwyppghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycm
evtpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaik
klveadalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdl
llvqsdlytlvdgfvtrn

Sequence, based on observed residues (ATOM records): (download)

>d2q4ja2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
enlpqlksavdgltemseseksgfislvsrylsgiewskiqtptdeivvpyekmtpvsqd
vaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygckv
plvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegwyp
pghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycmevtp
ktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikklve
adalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdlllvq
sdlytlvdgfvtrn

SCOPe Domain Coordinates for d2q4ja2:

Click to download the PDB-style file with coordinates for d2q4ja2.
(The format of our PDB-style files is described here.)

Timeline for d2q4ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q4ja1