SCOPe 2.03: Domain d2q4ja1: 2q4j A:384-469

Lineage for d2q4ja1 (2q4j A:384-469)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
   this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain

6. Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [141581] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141582] (4 PDB entries)
   Uniprot Q9M9P3 384-469

8. Domain d2q4ja1: 2q4j A:384-469 [139860]
   Other proteins in same PDB: d2q4ja2, d2q4jb2
   automated match to d1z90a1

Details for d2q4ja1

PDB Entry: 2q4j, 1.86 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At3g03250, a putative UDP-glucose pyrophosphorylase

PDB Compounds: (A:) Probable UTP-glucose-1-phosphate uridylyltransferase 2

SCOPe Domain Sequences for d2q4ja1:

Sequence; same for both SEQRES and ATOM records:

>d2q4ja1 b.81.1.4 (A:384-469) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvwfgssivlkgkvtva
aksgvkleipdravvenkningpedl

Timeline for d2q4ja1:

• d2q4ja1 first appeared in SCOP 1.73
  
• d2q4ja1 appears in SCOPe 2.02
  
• d2q4ja1 appears in SCOPe 2.04
  
• d2q4ja1 appears in the current release, SCOPe 2.08