Lineage for d2q4ja1 (2q4j A:384-469)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814014Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
    this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
  6. 2814054Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [141581] (1 species)
  7. 2814055Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141582] (4 PDB entries)
    Uniprot Q9M9P3 384-469
  8. 2814060Domain d2q4ja1: 2q4j A:384-469 [139860]
    Other proteins in same PDB: d2q4ja2, d2q4jb2
    automated match to d1z90a1
    has additional insertions and/or extensions that are not grouped together

Details for d2q4ja1

PDB Entry: 2q4j (more details), 1.86 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At3g03250, a putative UDP-glucose pyrophosphorylase
PDB Compounds: (A:) Probable UTP-glucose-1-phosphate uridylyltransferase 2

SCOPe Domain Sequences for d2q4ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q4ja1 b.81.1.4 (A:384-469) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvwfgssivlkgkvtva
aksgvkleipdravvenkningpedl

SCOPe Domain Coordinates for d2q4ja1:

Click to download the PDB-style file with coordinates for d2q4ja1.
(The format of our PDB-style files is described here.)

Timeline for d2q4ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q4ja2