Lineage for d2q4ic1 (2q4i C:20-193)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813942Fold b.159: AOC barrel-like [141492] (2 superfamilies)
    barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds
  4. 813943Superfamily b.159.1: Allene oxide cyclase-like [141493] (1 family) (S)
  5. 813944Family b.159.1.1: Allene oxide cyclase-like [141494] (1 protein)
    Pfam PF06351
  6. 813945Protein Allene oxide cyclase, AOC [141495] (2 species)
  7. 813948Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (5 PDB entries)
    Uniprot Q9LS02 80-253
  8. 813957Domain d2q4ic1: 2q4i C:20-193 [139859]
    automatically matched to 1Z8K A:20-193

Details for d2q4ic1

PDB Entry: 2q4i (more details), 1.71 Å

PDB Description: Ensemble refinement of the protein crystal structure of allene oxide cyclase from Arabidopsis thaliana At3g25770
PDB Compounds: (C:) Allene oxide cyclase 2

SCOP Domain Sequences for d2q4ic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q4ic1 b.159.1.1 (C:20-193) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]}
kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn

SCOP Domain Coordinates for d2q4ic1:

Click to download the PDB-style file with coordinates for d2q4ic1.
(The format of our PDB-style files is described here.)

Timeline for d2q4ic1: