Lineage for d2q4ib_ (2q4i B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2078127Fold b.159: AOC barrel-like [141492] (2 superfamilies)
    barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds
  4. 2078128Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families) (S)
  5. 2078129Family b.159.1.1: Allene oxide cyclase-like [141494] (2 protein domains)
    Pfam PF06351
  6. 2078130Protein Allene oxide cyclase, AOC [141495] (2 species)
  7. 2078133Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (5 PDB entries)
    Uniprot Q9LS02 80-253
  8. 2078139Domain d2q4ib_: 2q4i B: [139858]
    automated match to d1z8ka1

Details for d2q4ib_

PDB Entry: 2q4i (more details), 1.71 Å

PDB Description: Ensemble refinement of the protein crystal structure of allene oxide cyclase from Arabidopsis thaliana At3g25770
PDB Compounds: (B:) Allene oxide cyclase 2

SCOPe Domain Sequences for d2q4ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q4ib_ b.159.1.1 (B:) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]}
kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn

SCOPe Domain Coordinates for d2q4ib_:

Click to download the PDB-style file with coordinates for d2q4ib_.
(The format of our PDB-style files is described here.)

Timeline for d2q4ib_: