SCOP 1.73: Domain d2q4ia1: 2q4i A:20-193

Lineage for d2q4ia1 (2q4i A:20-193)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.159: Allene oxide cyclase-like [141492] (1 superfamily)
   barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds

4. Superfamily b.159.1: Allene oxide cyclase-like [141493] (1 family)

5. Family b.159.1.1: Allene oxide cyclase-like [141494] (1 protein)
   Pfam PF06351

6. Protein Allene oxide cyclase, AOC [141495] (2 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (2 PDB entries)

8. Domain d2q4ia1: 2q4i A:20-193 [139857]
   automatically matched to 1Z8K A:20-193

Details for d2q4ia1

PDB Entry: 2q4i, 1.71 Å

PDB Description: Ensemble refinement of the protein crystal structure of allene oxide cyclase from Arabidopsis thaliana At3g25770

PDB Compounds: (A:) Allene oxide cyclase 2

SCOP Domain Sequences for d2q4ia1:

Sequence; same for both SEQRES and ATOM records:

>d2q4ia1 b.159.1.1 (A:20-193) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]}
kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn

Timeline for d2q4ia1:

• d2q4ia1 is new in SCOP 1.73
  
• d2q4ia1 appears in SCOP 1.75
  
• d2q4ia1 appears in the current release, SCOPe 2.08, called d2q4ia_