SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2q4ha1 (2q4h A:23-195)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157128Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2157129Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2157220Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
    duplication: consists of 2 HIT-like motifs
    binds zinc and iron ions
  6. 2157221Protein Galactose-1-phosphate uridylyltransferase [54208] (3 species)
  7. 2157247Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110788] (5 PDB entries)
    Uniprot Q9FK51
  8. 2157252Domain d2q4ha1: 2q4h A:23-195 [139853]
    automatically matched to d1vkva1
    complexed with amp, edo, zn

Details for d2q4ha1

PDB Entry: 2q4h (more details), 1.83 Å

PDB Description: Ensemble refinement of the crystal structure of GALT-like protein from Arabidopsis thaliana At5g18200
PDB Compounds: (A:) Probable galactose-1-phosphate uridyl transferase

SCOPe Domain Sequences for d2q4ha1:

Sequence, based on SEQRES records: (download)

>d2q4ha1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pelrkdpvtnrwvifsparakrptdfkskspqnpnpkpsscpfcigreqecapelfrvpd
hdpnwklrvienlypalsrnletqstqpetgtsrtivgfgfhdvviespvhsiqlsdidp
vgigdiliaykkrinqiaqhdsinyiqvfknqgasagasmshshsqmmalpvv

Sequence, based on observed residues (ATOM records): (download)

>d2q4ha1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pelrkdpvtnrwvifsprptdfkskspsscpfcigreqecapelfrvpdhdpnwklrvie
nlypalsrnletqsrtivgfgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaq
hdsinyiqvfknqgasagasmshshsqmmalpvv

SCOPe Domain Coordinates for d2q4ha1:

Click to download the PDB-style file with coordinates for d2q4ha1.
(The format of our PDB-style files is described here.)

Timeline for d2q4ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q4ha2